PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G164200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 358aa    MW: 39553.2 Da    PI: 6.0962
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G164200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.8e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
  Sevir.6G164200.1.p 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding537.7e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Sevir.6G164200.1.p  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.932961IPR017930Myb domain
SuperFamilySSF466891.25E-3011108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001675.01E-111661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002494.1E-1667112IPR001005SANT/Myb domain
CDDcd001674.77E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRSPCCEKI GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKSIS GTLTGTADDK SAKVAASLSH MAQWESARLE AEARLARESK MRTAAPTPTT  180
LHGQQTNVPA STASPCLDVL HAWQGAKIDL ESPTSTLTFT GSNSGMLPTP RTNRLEVSES  240
NSVMWERSDE LEGEESDWQF YSRHQVLGLE GKEREEDFIG CEEPWFSGMA GVGAGFTGML  300
LDGSNEHDAS ECWGESSNGQ TEHSNQASDE EDKNYWNGVL GMVNSELPPQ SPPSPLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283140.0KJ728314.1 Zea mays clone pUT6594 MYB transcription factor (MYB28) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973509.10.0PREDICTED: transcription factor MYB32-like
TrEMBLK3YIC50.0K3YIC5_SETIT; Uncharacterized protein
STRINGSi013994m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-99myb domain protein 106